PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676737422
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family TALE
Protein Properties Length: 522aa    MW: 59341.4 Da    PI: 6.5664
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676737422genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.94.7e-103644011954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  676737422 364 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 401
                665559******************************88 PP

2BELL123.96.5e-40227298172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+v+glg+akpYts+Al++iSrhFrcL+dai+eq+
  676737422 227 ERQELQSKKNKLLTMVDEVDKRYNQYYHQMEALASSFEMVTGLGAAKPYTSVALNRISRHFRCLRDAIKEQV 298
                79********************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-52156296IPR006563POX domain
PfamPF075261.1E-47162294IPR006563POX domain
PROSITE profilePS5007112.422342405IPR001356Homeobox domain
SMARTSM003896.5E-10345409IPR001356Homeobox domain
CDDcd000867.16E-12345406No hitNo description
SuperFamilySSF466899.84E-18346413IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28348411IPR009057Homeodomain-like
PfamPF059206.5E-18362401IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MAVYYPTSVG MQSMYQESIY LNEQQQQQQQ QASSSSAASF SEIISGGGVR NEMVFIPPTS  60
NDVVVTGLSN GNVTVSSNDL SFHGGGLSLS LGNQIQYHYQ NLSNQLNYTN PNPSLSDENG  120
KSLSHDHHHN HQSEQIPTSG YGNGVGFYNN YRYETSGFVS SVLRSRYLKP TQQLLDEVVS  180
VRKDLKLGGG DSNKKIKSND KGQDFTNGSS DNNTDKEKLQ EELSPSERQE LQSKKNKLLT  240
MVDEVDKRYN QYYHQMEALA SSFEMVTGLG AAKPYTSVAL NRISRHFRCL RDAIKEQVQV  300
IRGKLGERES SDEQGERIPR LRYLDQRLRQ QRALHQQLGM VRPAWRPQRG LPENSVSILR  360
AWLFEHFLHP YPKESEKIML AKQTGLSKNQ VANWFINARV RLWKPMIEEM YKEEFGDASE  420
LLSNSNQDNK MQETSQLKHE DSSSSQQQNH GNNNNNNIPY TSEAEENLVF ADPKPDRATT  480
GDYDTLMNYH GFGVDDYNRY IGLGNQQDAR FSNPHQLHDF VV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16351409563Homeobox protein Meis2
3k2a_B3e-16351409563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3530930.0AF353093.1 Arabidopsis thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete cds.
GenBankAY0625450.0AY062545.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410; F1B16.6) mRNA, complete cds.
GenBankAY0852780.0AY085278.1 Arabidopsis thaliana clone 142443 mRNA, complete sequence.
GenBankAY5984520.0AY598452.1 Arabidopsis thaliana BEL1-like homeodomain 3 protein mRNA, complete cds.
GenBankBT0001330.0BT000133.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390306.10.0hypothetical protein EUTSA_v10018381mg
RefseqXP_006390307.10.0hypothetical protein EUTSA_v10018381mg
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLV4KK100.0V4KK10_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.2__1821__AT1G75410.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3